Description
Product Overview
TB500 10mg is a synthetic peptide formulated for use in biochemical, molecular, and analytical research. It is designed for investigations related to peptide structure, amino acid sequencing, and molecular interaction studies. This compound is synthesized using solid-phase peptide synthesis (SPPS) and undergoes purification through high-performance liquid chromatography (HPLC) to ensure exceptional purity and consistency. Each production batch is confirmed by mass spectrometry (MS) to verify molecular structure and sequence integrity. For Research Use Only. Not for human or veterinary use.
Key Features
- Synthetic peptide developed for structural and biochemical research
- High analytical purity confirmed by HPLC and MS testing
- Supplied as a stable lyophilized powder for research applications
- Manufactured under strict laboratory-grade quality control protocols
Specifications
- Compound Type: Synthetic Peptide
- Amino Acid Sequence: Ac–SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form: Lyophilized Powder
- Concentration: 10mg per vial
- Purity: ≥99% (HPLC validated)
- Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
- Molecular Weight: Approximately 4963.5 g/mol
- Appearance: White to off-white crystalline powder
Storage and Stability
- Store at –20°C in a dry, light-protected environment
- Avoid repeated freeze–thaw cycles to maintain molecular stability
- Reconstitute under sterile laboratory conditions using appropriate research-grade solvents
- After reconstitution, store at 2–8°C and use within a limited time for optimal performance
Intended Use
This compound is intended solely for scientific and laboratory research, including peptide mapping, molecular modeling, and analytical studies under controlled in-vitro conditions. It is not approved for human or animal use, and must not be employed in diagnostic, therapeutic, or clinical applications. All procedures should be conducted by qualified research professionals in accordance with Good Laboratory Practice (GLP) and institutional safety guidelines. For Research Use Only.
